PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT03425
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 514aa    MW: 57277.5 Da    PI: 7.1209
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT03425genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.97e-521552851128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
               +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+e+d++k+ePwdL+   ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++   ++
  EMT03425 155 VPPGFRFHPTDEELLYYYLRKKVAYEAIDL-DVIREIDLNKLEPWDLKDrcRIGTgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIFLGsGS 254
               69****************************.9***************943444442456*************************************97677 PP

       NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
               + +g++ktLvfy grap+g+ktdW+mheyrl
  EMT03425 255 RRIGMRKTLVFYVGRAPHGKKTDWIMHEYRL 285
               88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-59146305IPR003441NAC domain
PROSITE profilePS5100558.306155305IPR003441NAC domain
PfamPF023652.1E-27156285IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MATEDTDPKS SATVAAAIPF FPHLYEHENK RDIHARSSSA ARLVTTRRGL RVERRTRTHS  60
SSRHRFLNTV LLLRSSSSRL AACTAALCAT TDFFVTDTPD PDDDYFPDVD NLLHDMATEN  120
TDPKSSATVA AVVPSILGPA RERASMHPSG GALSVPPGFR FHPTDEELLY YYLRKKVAYE  180
AIDLDVIREI DLNKLEPWDL KDRCRIGTGP QNEWYFFSHK DKKYPTGTRT NRATTAGFWK  240
ATGRDKAIFL GSGSRRIGMR KTLVFYVGRA PHGKKTDWIM HEYRLDEDNV EVQEDGWVVC  300
RVFTKKSYTR GVNPAEMAGY DDDELLHPFP VPSSTAGAMQ MITDQKHIMH NPGHLMQQQQ  360
QQHYDFPSFD ASMQLPQLMS AEHEQQTLSS FLPGAPAAVA MSSHELECSQ NLMKLTSSGA  420
NGMLHHGGGG GGGDPRFPGT DWSILDKLLA SHQNLDQLFQ GKVAAAAAAS MVPYQQQHRQ  480
QLMEQLGGSS TSSMQRMPLQ YLGCEAADLL RFSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5015330715167NO APICAL MERISTEM PROTEIN
1ut4_B2e-5015330715167NO APICAL MERISTEM PROTEIN
1ut7_A2e-5015330715167NO APICAL MERISTEM PROTEIN
1ut7_B2e-5015330715167NO APICAL MERISTEM PROTEIN
3swm_A2e-5015330718170NAC domain-containing protein 19
3swm_B2e-5015330718170NAC domain-containing protein 19
3swm_C2e-5015330718170NAC domain-containing protein 19
3swm_D2e-5015330718170NAC domain-containing protein 19
3swp_A2e-5015330718170NAC domain-containing protein 19
3swp_B2e-5015330718170NAC domain-containing protein 19
3swp_C2e-5015330718170NAC domain-containing protein 19
3swp_D2e-5015330718170NAC domain-containing protein 19
4dul_A2e-5015330715167NAC domain-containing protein 19
4dul_B2e-5015330715167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281860.0AB028186.1 Oryza sativa mRNA for OsNAC7 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560688.10.0PREDICTED: NAC domain-containing protein 76-like
TrEMBLN1QTF80.0N1QTF8_AEGTA; Uncharacterized protein
STRINGMLOC_17128.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34613781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.33e-94NAC family protein